Structure of PDB 6x1t Chain G Binding Site BS01

Receptor Information
>6x1t Chain G (length=217) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVKESEGGLFKPTDTLTLTCTASGFSLNGYGVIWVRQAPGKGLEWIGSA
GAYGRIYYPNWARSRATITRNTNLNTVSLKMTSLTAADTATYFCARRTNV
STSVGFDSWGPGTLVTVSSSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLV
KGYLPEPVTVTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSVTCNVA
HPATNTKVDKTVAPSTC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x1t Structural basis for differential recognition of phosphohistidine-containing peptides by 1-pHis and 3-pHis monoclonal antibodies.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		G52 Y54 G55 R56 Y58 R95 V98 S100A
Binding residue
(residue number reindexed from 1)		G51 Y53 G54 R55 Y57 R97 V100 S103
External links