Structure of PDB 6wl2 Chain G Binding Site BS01

Receptor Information
>6wl2 Chain G (length=177) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRAR
WMEQECPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISG
CEVGSDGRLLRGYQQYAYDGQDYIALNEDLKTWTAADMAALITKHKWEQA
GEAERLRAYLEGTCVEWLRRYLKNGNA
Ligand information
>6wl2 Chain H (length=8) Species: 11276 (Vesicular stomatitis virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGYVYQGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wl2 Pre-T cell receptors topologically sample self-ligands during thymocyte beta-selection.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y7 E63 N70 S73 F74 D77 L81 V97 S99 Y123 T143 W147 E152 R155 L156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 E63 N70 S73 F74 D77 L81 V97 S99 Y123 T143 W147 E152 R155 L156 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wl2, PDBe:6wl2, PDBj:6wl2
PDBsum6wl2
PubMed33335016
UniProtP01901|HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain (Gene Name=H2-K1)

[Back to BioLiP]