Structure of PDB 6w6v Chain G Binding Site BS01

Receptor Information
>6w6v Chain G (length=126) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSV
HKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVIT
EDVEDDDKETQLKKRAVSGVELRIYV
Ligand information
>6w6v Chain A (length=294) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auccaugaccaaagaaucgucacaaaucgaagcuuacaaaauggaguaaa
auuuuacucaguaauaugcuuuggguugaaagucucccaccaauucguau
gcggaaaacguaaugagauuuaaaaauaaaucaacucauuaaggaggaug
ccgguauucugcuucuugaccugguaccucuaggguacugguguucggua
cuggauuccgauggaaucuaaaccauaguuaugacgauugcucuuuccug
gaucgaguaacccaauggagcuuacuauucuugguccauggauu
<<<<<<<<<<<<<.<<<<<<<......<<<<<<..........<<<<<<<
..>>>>>>>........>>>>>>{......[[.((((.<<<.........
<<<.....>>><<<<<<.................>>>>>>.<<.<<<<<<
<<>>>>>>>>.>>.......<<<<<<<<.<<>>>>>>>>>>.....>>>.
..<<<<<<<...>>>>>>>.............>>>>>>><<<<..<<<.>
>>..>>>>...}....))))]]...>....>>>>>>.>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w6v Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P19 T25 F34 K36 S37 T39 Y41 V42 S43 K46 R47 L66 G67 M68 K70 K74 H81 Q85 T96 I97 R129 A130 V131 S132
Binding residue
(residue number reindexed from 1)		P14 T20 F29 K31 S32 T34 Y36 V37 S38 K41 R42 L61 G62 M63 K65 K69 H76 Q80 T91 I92 R115 A116 V117 S118
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6v, PDBe:6w6v, PDBj:6w6v
PDBsum6w6v
PubMed32651392
UniProtP38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)

[Back to BioLiP]