Structure of PDB 6tmi Chain G Binding Site BS01

Receptor Information
>6tmi Chain G (length=180) Species: 507601 (Toxoplasma gondii GT1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTLEGRYASALFRVAKKKNQLEKVYGDLESVRNALKDSSEFRLFVDSPAV
SVQQKLDVLRQLVNRYKFDPLTGNLLTTLVENKRLPMLARVADAFDAMYR
KEKGEVKCLVTSAKPLSAQQQKEIVAALQNRAGTQARLIIDYAVSPQIMG
GLVVRLGEQVLDFSVATRLDRLQSQLLAPL
Ligand information
>6tmi Chain C (length=20) Species: 507601 (Toxoplasma gondii GT1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AKISPSEMSRLLEERIAGWK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tmi ATP synthase hexamer assemblies shape cristae of Toxoplasma mitochondria.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R240 L248 L252
Binding residue
(residue number reindexed from 1)		R168 L176 L180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0016020 membrane
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tmi, PDBe:6tmi, PDBj:6tmi
PDBsum6tmi
PubMed33402698
UniProtA0A125YKF8

[Back to BioLiP]