Structure of PDB 6sxb Chain G Binding Site BS01

Receptor Information

>6sxb Chain G (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLH
PDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILA
WSPEEAGRYLETYKAYEQKPADLDFVSRVTECLTTVKSVNKTDSQTLLTT
FGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP

Ligand information

>6sxb Chain C (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cagatgctga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6sxb Cryo-EM structures of the XPF-ERCC1 endonuclease reveal how DNA-junction engagement disrupts an auto-inhibited conformation.
Resolution	7.9 Å
Binding residue (original residue number in PDB)	K243 S244 R284
Binding residue (residue number reindexed from 1)	K137 S138 R178

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000014	single-stranded DNA endodeoxyribonuclease activity
GO:0001094	TFIID-class transcription factor complex binding
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003697	single-stranded DNA binding
GO:0005515	protein binding
GO:1990599	3' overhang single-stranded DNA endodeoxyribonuclease activity
GO:1990841	promoter-specific chromatin binding

	Biological Process
GO:0000720	pyrimidine dimer repair by nucleotide-excision repair
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0006302	double-strand break repair
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0006310	DNA recombination
GO:0006312	mitotic recombination
GO:0006949	syncytium formation
GO:0006974	DNA damage response
GO:0006979	response to oxidative stress
GO:0007281	germ cell development
GO:0007283	spermatogenesis
GO:0007584	response to nutrient
GO:0008283	cell population proliferation
GO:0008340	determination of adult lifespan
GO:0008584	male gonad development
GO:0009650	UV protection
GO:0009744	response to sucrose
GO:0010165	response to X-ray
GO:0032205	negative regulation of telomere maintenance
GO:0035166	post-embryonic hemopoiesis
GO:0035264	multicellular organism growth
GO:0035902	response to immobilization stress
GO:0036297	interstrand cross-link repair
GO:0045190	isotype switching
GO:0046686	response to cadmium ion
GO:0048009	insulin-like growth factor receptor signaling pathway
GO:0048468	cell development
GO:0048477	oogenesis
GO:0048568	embryonic organ development
GO:0051276	chromosome organization
GO:0060261	positive regulation of transcription initiation by RNA polymerase II
GO:0061819	telomeric DNA-containing double minutes formation
GO:0070914	UV-damage excision repair
GO:0090399	replicative senescence
GO:0090656	t-circle formation
GO:1904431	positive regulation of t-circle formation
GO:1905765	negative regulation of protection from non-homologous end joining at telomere

	Cellular Component
GO:0000109	nucleotide-excision repair complex
GO:0000110	nucleotide-excision repair factor 1 complex
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0070522	ERCC4-ERCC1 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6sxb, PDBe:6sxb, PDBj:6sxb
PDBsum	6sxb
PubMed	32111838
UniProt	P07992\|ERCC1_HUMAN DNA excision repair protein ERCC-1 (Gene Name=ERCC1)

[Back to BioLiP]