Structure of PDB 6se0 Chain G Binding Site BS01

Receptor Information
>6se0 Chain G (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVL
PNIQAVLL
Ligand information
>6se0 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6se0 CENP-C unwraps the human CENP-A nucleosome through the H2A C-terminal tail.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R11 K13 R29 R42 V43 G44 A45 T76 R77
Binding residue
(residue number reindexed from 1)		R3 K5 R21 R34 V35 G36 A37 T68 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6se0, PDBe:6se0, PDBj:6se0
PDBsum6se0
PubMed31475439
UniProtQ6FI13|H2A2A_HUMAN Histone H2A type 2-A (Gene Name=H2AC18)

[Back to BioLiP]