Structure of PDB 6s1c Chain G Binding Site BS01

Receptor Information
>6s1c Chain G (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPI
Ligand information
>6s1c Chain H (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s1c Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
Resolution6.1 Å
Binding residue
(original residue number in PDB)
P2 Q36 G37 E38 E40 Q88 N111 K126 D127 R128 P129
Binding residue
(residue number reindexed from 1)
P1 Q35 G36 E37 E39 Q87 N110 K125 D126 R127 P128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6s1c, PDBe:6s1c, PDBj:6s1c
PDBsum6s1c
PubMed32585006
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]