Structure of PDB 6qdv Chain G Binding Site BS01

Receptor Information
>6qdv Chain G (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEH
YDIPKVSWTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
K107 V108 S109
Binding residue
(residue number reindexed from 1)
K55 V56 S57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtQ9Y421|FA32A_HUMAN Protein FAM32A (Gene Name=FAM32A)

[Back to BioLiP]