Structure of PDB 6pep Chain G Binding Site BS01

Receptor Information
>6pep Chain G (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHD
PNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFL
KRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQN
Ligand information
>6pep Chain e (length=28) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLKGRSFQYGAEGYIKMSPGHWYFPSPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pep T3S injectisome needle complex structures in four distinct states reveal the basis of membrane coupling and assembly.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K66 K67 I68 T69 K83 Q87
Binding residue
(residue number reindexed from 1)		K40 K41 I42 T43 K57 Q61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion

View graph for
Biological Process
External links
PDB RCSB:6pep, PDBe:6pep, PDBj:6pep
PDBsum6pep
PubMed31427728
UniProtP35672|SCTC1_SALTY SPI-1 type 3 secretion system secretin (Gene Name=sctC1)

[Back to BioLiP]