Structure of PDB 6o1m Chain G Binding Site BS01

Receptor Information
>6o1m Chain G (length=66) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPVRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o1m Architectural principles for Hfq/Crc-mediated regulation of gene expression.
Resolution3.15 Å
Binding residue
(original residue number in PDB)
Y25 G29 I30 K31 L32 Q33 N48 Q52 T61
Binding residue
(residue number reindexed from 1)
Y21 G25 I26 K27 L28 Q29 N44 Q48 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6o1m, PDBe:6o1m, PDBj:6o1m
PDBsum6o1m
PubMed30758287
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]