Structure of PDB 6lf9 Chain G Binding Site BS01

Receptor Information
>6lf9 Chain G (length=273) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVP
WIQQEGQDYWDEETRKVKDNAQTYGVGLNTLRGYYNQSEAGSHTLQSMFG
CYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAA
NVAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lf9 Peptidomes and Structures Illustrate How SLA-I Micropolymorphism Influences the Preference of Binding Peptide Length.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
Y7 E55 E63 K66 T73 V76 Y84 T143 K146 W147 A150 R155 Y159 L163 S167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E55 E63 K66 T73 V76 Y84 T143 K146 W147 A150 R155 Y159 L163 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links