Structure of PDB 6ldi Chain G Binding Site BS01

Receptor Information
>6ldi Chain G (length=127) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLL
RQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQS
MRDQLLALANACPGDDSADCPIIENLS
Ligand information
>6ldi Chain 1 (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cttgaccttccccttgctggaaggtttataatgggagctgtcacggatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ldi CueR activates transcription through a DNA distortion mechanism.
Resolution3.69 Å
Binding residue
(original residue number in PDB)		T13 K15 F19 Y20 R54 L60
Binding residue
(residue number reindexed from 1)		T13 K15 F19 Y20 R54 L60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005507 copper ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ldi, PDBe:6ldi, PDBj:6ldi
PDBsum6ldi
PubMed32989300
UniProtP0A9G4|CUER_ECOLI HTH-type transcriptional regulator CueR (Gene Name=cueR)

[Back to BioLiP]