Structure of PDB 6lc1 Chain G Binding Site BS01

Receptor Information

>6lc1 Chain G (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRR
RNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPS

Ligand information

>6lc1 Chain I (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agtgatatttacctccaaatgccagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	E285 G286 F290 R293 R316 N317 R323 R345 G347 R348 S351
Binding residue (residue number reindexed from 1)	E20 G21 F25 R28 R51 N52 R58 R80 G82 R83 S86
Binding affinity	PDBbind-CN: Kd=135.33nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
PDBsum	6lc1
PubMed	31822342
UniProt	P22736\|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)

[Back to BioLiP]