Structure of PDB 6kvd Chain G Binding Site BS01

Receptor Information
>6kvd Chain G (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQA
VLLPK
Ligand information
>6kvd Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kvd Biochemical and structural analyses of the nucleosome containing human histone H2A.J.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		R29 R35 R42 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R16 R22 R29 G31 A32 K62 T63 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0007283 spermatogenesis
GO:0008150 biological_process
GO:0021987 cerebral cortex development
GO:0031507 heterochromatin formation
GO:0071480 cellular response to gamma radiation
GO:0090398 cellular senescence
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kvd, PDBe:6kvd, PDBj:6kvd
PDBsum6kvd
PubMed31793981
UniProtQ9BTM1|H2AJ_HUMAN Histone H2A.J (Gene Name=H2AJ)

[Back to BioLiP]