Structure of PDB 6k0b Chain G Binding Site BS01

Receptor Information
>6k0b Chain G (length=120) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKFLEKKLKKIAYERIDILMSLAEEEAKKGNWDRAKRYVYLARRIAMKMR
IRFPKKWKRRICKKCGTFLLYGRNARVRIKSKRYPHVVITCLECGAIYRI
PMIREKKEKRRKKLEERLKA
Ligand information
>6k0b Chain U (length=83) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggugggguucccgagcggccaaagggagcagacucuaaaucugccgucau
cgacuucgaagguucgaauccuucccccaccac
<<<<<<<..<<<...........>>>.<<<<<.......>>>>>.<<<..
.>>>...<<<<<.......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		K8 K10 M48 K49 R51
Binding residue
(residue number reindexed from 1)		K7 K9 M47 K48 R50
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004526 ribonuclease P activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006396 RNA processing
GO:0008033 tRNA processing
Cellular Component
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtQ58372|RNP4_METJA Ribonuclease P protein component 4 (Gene Name=rnp4)

[Back to BioLiP]