Structure of PDB 6ifr Chain G Binding Site BS01

Receptor Information
>6ifr Chain G (length=217) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAINSPVIKDPITNLPIIPGSS
LKGKMRTLLAKVYNEKVAEKPSDDSDILSRLFGNSKDKRFKMGRLIFRDA
FLSNADELDSLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFEL
IYEITDENENQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFENLKAT
TVFGNYDVKTLNELLTA
Ligand information
>6ifr Chain N (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuacccau
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifr Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I20 G21 S50 S51 K53 G54 K55 R57 T58 G84 S86 F122 E123 N124 T125 I126 R128 R136 Y181 G184 G186 R188
Binding residue
(residue number reindexed from 1)		I19 G20 S49 S50 K52 G53 K54 R56 T57 G83 S85 F121 E122 N123 T124 I125 R127 R135 Y180 G183 G185 R187
External links