Structure of PDB 6he5 Chain G Binding Site BS01

Receptor Information

>6he5 Chain G (length=242) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

QMGYDRAITVFSPDGRLFQVEYAREAVKRGATAIGIKCKEGVILIADKRV
GSKLLEADTIEKIYKIDEHICAATSGLVADARVLIDRARIEAQINRLTYD
EPITVKELAKKICDFKQQYTQYGGVRPFGVSLLIAGVDEVPKLYETDPSG
ALLEYKATAIGMGRNAVTEFFEKEYRDDLSFDDAMVLGLVAMGLSIESEL
VPENIEVGYVKVDDRTFKEVSPEELKPYVERANERIRELLKK

Ligand information

>6he5 Chain L (length=9) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

PDLKGVMFV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6he5 Cryo-EM structures of the archaeal PAN-proteasome reveal an around-the-ring ATPase cycle.
• Resolution: 4.12 Å
• Binding residue (original residue number in PDB): R33 G34 A35 V54 K66 G80 L81
• Binding residue (residue number reindexed from 1): R29 G30 A31 V50 K62 G76 L77

Enzymatic activity

• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding

Biological Process

• GO:0006511 ubiquitin-dependent protein catabolic process
• GO:0010498 proteasomal protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0019773 proteasome core complex, alpha-subunit complex

External links

• PDB: RCSB:6he5, PDBe:6he5, PDBj:6he5
• PDBsum: 6he5
• PubMed: 30559193
• UniProt: O29760|PSA_ARCFU Proteasome subunit alpha (Gene Name=psmA)