Structure of PDB 6hc3 Chain G Binding Site BS01

Receptor Information
>6hc3 Chain G (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELP
DSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKA
MTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNL
SDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hc3 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K51 K52 V54 L58 K62 I81 K147 R157 P158 S160 Y162 Q179 L182 K183 K186 E208 Y211 R232 R233 T234
Binding residue
(residue number reindexed from 1)
K9 K10 V12 L16 K20 I39 K105 R115 P116 S118 Y120 Q137 L140 K141 K144 E166 Y169 R190 R191 T192
Binding affinityPDBbind-CN: Kd=13.6nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hc3, PDBe:6hc3, PDBj:6hc3
PDBsum6hc3
PubMed31114891
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]