Structure of PDB 6gov Chain G Binding Site BS01

Receptor Information
>6gov Chain G (length=172) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMVPTEEVVRRK
SERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVD
AIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLK
VSVSIFGRATPVELDFSQVEKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gov Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		F18 R21
Binding residue
(residue number reindexed from 1)		F15 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gov, PDBe:6gov, PDBj:6gov
PDBsum6gov
PubMed30795892
UniProtP0AFG0|NUSG_ECOLI Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]