Structure of PDB 6gl1 Chain G Binding Site BS01

Receptor Information
>6gl1 Chain G (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAP
WMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHG
CELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDA
SEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHEATLRCWA
LGFYPAEITLTTQDTELVETRPAGDGTFQKWAACHVQHEGLPEPVTLRW
Ligand information
>6gl1 Chain T (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RMYSPTSIL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gl1 Pathogen-derived HLA-E bound epitopes reveal broad primary anchor pocket tolerability and conformationally malleable peptide binding.
Resolution2.623 Å
Binding residue
(original residue number in PDB)
Y7 H9 R62 E63 S66 A67 T70 I73 N77 Y84 S143 K146 E152 H155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 H9 R62 E63 S66 A67 T70 I73 N77 Y84 S143 K146 E152 H155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gl1, PDBe:6gl1, PDBj:6gl1
PDBsum6gl1
PubMed30087334
UniProtP13747|HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E (Gene Name=HLA-E)

[Back to BioLiP]