Structure of PDB 6f2s Chain G Binding Site BS01

Receptor Information

>6f2s Chain G (length=195) Species: 44560 (Ageratum yellow vein virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSDVTRGNGLTHRVGKRFCV
KSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGTAMDFGQVFNMYDN
EPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALVKKFMKINNYVVY
NHQEAAKYDNHTENALLLYMACTHASNPVYATLKIRIYFYDSVQN

Ligand information

>6f2s Chain O (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caaccac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6f2s The 3.3 angstrom structure of a plant geminivirus using cryo-EM.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R109 N257
Binding residue (residue number reindexed from 1)	R47 N195

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6f2s, PDBe:6f2s, PDBj:6f2s
PDBsum	6f2s
PubMed	29915210
UniProt	W5RUR4

[Back to BioLiP]