Structure of PDB 6bli Chain G Binding Site BS01

Receptor Information
>6bli Chain G (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLQESGPRLVKPSETLSLTCTVSGGSTSSYFWNWIRQPPGKGLEWIGY
IYGSGSADYNPSLKSRVTISIDTSKTQFSLKLTSVTAADTAVYYCARSGF
CSDDACYRRGSWFDPWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVEPK
Ligand information
>6bli Chain I (length=28) Species: 11256 (Human respiratory syncytial virus (strain RSB6256)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FHFEVFNFVPCSICSNNPTCWAICKRIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bli Structural basis for recognition of the central conserved region of RSV G by neutralizing human antibodies.
Resolution2.12 Å
Binding residue
(original residue number in PDB)
S30 Y52 F97 D100 D100A A100B C100C Y100D R100F
Binding residue
(residue number reindexed from 1)
S30 Y52 F100 D103 D104 A105 C106 Y107 R109
External links