Structure of PDB 6bba Chain G Binding Site BS01

Receptor Information
>6bba Chain G (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFL
QSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGS
LLLAAGTPGMRHSLPNSRIMIHQPSATDIAIQAEEIMKLKKQLYNIYAKH
TKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bba Acyldepsipeptide Analogs Dysregulate Human Mitochondrial ClpP Protease Activity and Cause Apoptotic Cell Death.
Resolution2.796 Å
Binding residue
(original residue number in PDB)		L147 T178 Y181
Binding residue
(residue number reindexed from 1)		L48 T79 Y82
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6bba, PDBe:6bba, PDBj:6bba
PDBsum6bba
PubMed30126533
UniProtQ16740|CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial (Gene Name=CLPP)

[Back to BioLiP]