Structure of PDB 6agb Chain G Binding Site BS01

Receptor Information
>6agb Chain G (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSY
VAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGSDVED
DDKETQLKKRAVSGVELRIYV
Ligand information
>6agb Chain A (length=369) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaacagugguaauuccuacgauuaagaaaccuguuuacagaaggauc
cccaccuaugggcggguuaucagauauuaucaggugggaaauucggugga
acacaguggagccuuguccuccggguuaaugucgcuuuuggcauuggccc
cugcuccugagagaagaaauauacuggggaaccagucuuuaccgaccguu
guuaucagaaauucacggaguucggccuaggucggacuccgaugggaacg
gcaacgguuguuccguuugacuugucgcccgcuacggcgugagcgucaag
gucuguugagugcaaucguaggacgucauuaguggcgaacccgauaccga
uuacugcugcuguuccagc
.<<<<<<<<<<<<<..<<<<<<<........<<<<<..........<<<.
<<<.<<....>>.>>>..>>>.........>>>>>[[...{{.(((((..
......<<<<<<.........<<<<<<<<<<<<<....>>>>>>>>>>>>
...<<....>>.<<........<<<<<....>>>>>.>>....>..<<<<
<<.............<<<<<<<<<<<....>>>>>>>>>>>.........
>>>>>>...>>>>>>...<<<<<<.<<<.<<<....>>>...>>>.>>>.
>>>.............>>>>>>><<<<<....>>>>>..]]...)))))}
}...>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6agb Structural insight into precursor tRNA processing by yeast ribonuclease P.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		V15 K17 H18 P19 S20 K22 H26 Q28 H30 T32 F34 V35 K36 T39 P40 Y41 V42 S43 L45 K46 R47 K50 F51 K57 Q58 G59 S60 Y62 L66 G67 M68 K70 E73 H81 I97 V99 R129 A130 S132
Binding residue
(residue number reindexed from 1)		V3 K5 H6 P7 S8 K10 H14 Q16 H18 T20 F22 V23 K24 T27 P28 Y29 V30 S31 L33 K34 R35 K38 F39 K45 Q46 G47 S48 Y50 L54 G55 M56 K58 E61 H69 I85 V87 R110 A111 S113
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6agb, PDBe:6agb, PDBj:6agb
PDBsum6agb
PubMed30262633
UniProtP38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)

[Back to BioLiP]