Structure of PDB 5zko Chain G Binding Site BS01

Receptor Information
>5zko Chain G (length=43) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zko Structural Insights into the CRTC2-CREB Complex Assembly on CRE.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R20 K21 F22
Binding residue
(residue number reindexed from 1)		R5 K6 F7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008140 cAMP response element binding protein binding
Biological Process
GO:0032793 positive regulation of CREB transcription factor activity
GO:0051289 protein homotetramerization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zko, PDBe:5zko, PDBj:5zko
PDBsum5zko
PubMed29733854
UniProtQ3U182|CRTC2_MOUSE CREB-regulated transcription coactivator 2 (Gene Name=Crtc2)

[Back to BioLiP]