Structure of PDB 5yd4 Chain G Binding Site BS01

Receptor Information
>5yd4 Chain G (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQQSGAELVRPGTSVKMSCKAAGYTFTKYWIGWVKQRPGHGLEWIGDI
HPGSFYSNYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAIYYCARDYY
TNYGDWGQGTSVTVSDIVMTQAAPSVSVTPGESVSISCRSSKSLLHRNGN
TYLFWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEA
EDVGVYYCMQHLEYPYTFGSGTKLEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yd4 Intramolecular H-bonds govern the recognition of a flexible peptide by an antibody
Resolution1.35 Å
Binding residue
(original residue number in PDB)		W35 D52 H54 S57 Y59 T104 Y177 H236 E238 Y239 Y241
Binding residue
(residue number reindexed from 1)		W32 D49 H51 S54 Y56 T101 Y152 H211 E213 Y214 Y216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yd4, PDBe:5yd4, PDBj:5yd4
PDBsum5yd4
PubMed29924367
UniProtP01630|KV2A6_MOUSE Ig kappa chain V-II region 7S34.1

[Back to BioLiP]