Structure of PDB 5xs0 Chain G Binding Site BS01

Receptor Information
>5xs0 Chain G (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINL
ANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDV
GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xs0 Structural Basis of Homology-Directed DNA Repair Mediated by RAD52
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G58 K102 Y104 E130 G131 L132 K133 S134 L137
Binding residue
(residue number reindexed from 1)		G34 K78 Y80 E106 G107 L108 K109 S110 L113
Binding affinityPDBbind-CN: Kd=5.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0045002 double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xs0, PDBe:5xs0, PDBj:5xs0
PDBsum5xs0
PubMed30428330
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]