Structure of PDB 5wqd Chain G Binding Site BS01

Receptor Information
>5wqd Chain G (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLG
KEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTE
FTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMTTQKLRNDLL
NIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wqd NBS1 Phosphorylation Status Dictates Repair Choice of Dysfunctional Telomeres
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R80 Q84 L87 L101 R102 M104 Q105 D117 C118 S119 F120 E142
Binding residue
(residue number reindexed from 1)		R38 Q42 L45 L59 R60 M62 Q63 D75 C76 S77 F78 E100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wqd, PDBe:5wqd, PDBj:5wqd
PDBsum5wqd
PubMed28216226
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]