Structure of PDB 5we0 Chain G Binding Site BS01

Receptor Information

>5we0 Chain G (length=218) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHE
KMPIFMDIAFIEYCFNLSLDPSQQILWEYSLISNALERLENIELERQNCM
RELLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDW
GEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQL
EVFCDYDFKQREIVKMLT

Ligand information

>5we0 Chain H (length=29) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ACEMCRLGLPHGSFFELLRDWKKIEEFRN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5we0 Structural Basis for Shelterin Bridge Assembly.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	F18 Y24 M26 N35 L38 R39 L41 G42 Y43 M47 C48 H49 M52 F60 Y63 C64 Q88 I89 L95 N98 R102
Binding residue (residue number reindexed from 1)	F18 Y24 M26 N35 L38 R39 L41 G42 Y43 M47 C48 H49 M52 F60 Y63 C64 Q74 I75 L81 N84 R88

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0000723	telomere maintenance
GO:0016233	telomere capping
GO:0032200	telomere organization

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070187	shelterin complex
GO:0140445	chromosome, telomeric repeat region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5we0, PDBe:5we0, PDBj:5we0
PDBsum	5we0
PubMed	29149597
UniProt	O13852\|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]