Structure of PDB 5vx3 Chain G Binding Site BS01

Receptor Information
>5vx3 Chain G (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRY
RRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALC
VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
Ligand information
>5vx3 Chain H (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MRPEIRIAQELRRIGDEFNATYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vx3 Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution1.945 Å
Binding residue
(original residue number in PDB)		F97 Y101 R103 A104 Q111 L112 Q125 V126 E129 L130 D133 N136 G138 R139 L194 Y195
Binding residue
(residue number reindexed from 1)		F46 Y50 R52 A53 Q60 L61 Q74 V75 E78 L79 D82 N85 G87 R88 L143 Y144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vx3, PDBe:5vx3, PDBj:5vx3
PDBsum5vx3
PubMed29149594
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]