Structure of PDB 5ujt Chain G Binding Site BS01

Receptor Information

>5ujt Chain G (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GEDIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLP
LFRRFRRFDPQFALTNIAVLKHNLNCVIKRSNSTAATNEVPEVTVFSKSP
VTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFF
KISYLTFLPSDDEIYDCKVEHWGLDEPLLKHW

Ligand information

>5ujt Chain C (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VEELYLVAGEEGCGG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ujt C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes.
Resolution	1.94 Å
Binding residue (original residue number in PDB)	E-1 E85 G169 D171
Binding residue (residue number reindexed from 1)	E2 E89 G173 D175

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ujt, PDBe:5ujt, PDBj:5ujt
PDBsum	5ujt
PubMed	29255035
UniProt	Q5Y7C3

[Back to BioLiP]