Structure of PDB 5tkj Chain G Binding Site BS01

Receptor Information
>5tkj Chain G (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGTELVWPGTSVTLSCKASGYTFTDYEIHWVKQTPVHGLEWIGA
IVPKTGYTAYNQKFRGKAILTADKSSSTAYMDLRRLTSEDSAVYYCTRLR
NYWYFDVWGTGTTVTVSPASTKGPSVFPLAPALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT
KVDKKVEP
Ligand information
>5tkj Chain I (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tkj Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution2.118 Å
Binding residue
(original residue number in PDB)		E33 A50 Y56 L95 N97 Y98 W99
Binding residue
(residue number reindexed from 1)		E33 A50 Y57 L99 N101 Y102 W103
External links