Structure of PDB 5tbd Chain G Binding Site BS01

Receptor Information
>5tbd Chain G (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLTLSVTIGQPASISCKSSQSLLHSNGKTYLNWLLQRPGQSPK
RLIYLVSKLDSGVPDRFTGSGSGTDFTLKISSVEAEDLGVYYCWQGTHFP
ITFGSGTKLEIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tbd Structure and Characterisation of a Key Epitope in the Conserved C-Terminal Domain of the Malaria Vaccine Candidate MSP2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		H31 Y37 N39 R51 Y54 G96
Binding residue
(residue number reindexed from 1)		H31 Y37 N39 R51 Y54 G96
External links