Structure of PDB 5osi Chain G Binding Site BS01

Receptor Information
>5osi Chain G (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLK
TLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLA
LLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSF
VLMDIQASTVVTYVYQLIGDDVKVERIEYKKP
Ligand information
>5osi Chain I (length=12) Species: 933093 (Legionella pneumophila subsp. pneumophila ATCC 43290) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEYTPTIPPKAI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5osi Molecular mechanism for the subversion of the retromer coat by the Legionella effector RidL.
Resolution2.52 Å
Binding residue
(original residue number in PDB)		L25 K30 Y163 Y165 V174 R176
Binding residue
(residue number reindexed from 1)		L25 K30 Y163 Y165 V174 R176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006886 intracellular protein transport
GO:0010506 regulation of autophagy
GO:0015031 protein transport
GO:0032456 endocytic recycling
GO:0042147 retrograde transport, endosome to Golgi
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5osi, PDBe:5osi, PDBj:5osi
PDBsum5osi
PubMed29229824
UniProtQ9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 (Gene Name=VPS29)

[Back to BioLiP]