Structure of PDB 5lmx Chain G Binding Site BS01

Receptor Information

NCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYE
GLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQP

Ligand information

TATTLNTPVVIHATQLPQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	5lmx The dynamic assembly of distinct RNA polymerase I complexes modulates rDNA transcription.
Resolution	4.9 Å
Binding residue (original residue number in PDB)	V39 R40 V41 P42 I43 A44 L45 Y46 S48 Q64 H65 K76 F113
Binding residue (residue number reindexed from 1)	V4 R5 V6 P7 I8 A9 L10 Y11 S13 Q29 H30 K41 F75

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0005515	protein binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006352	DNA-templated transcription initiation
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:5lmx, PDBe:5lmx, PDBj:5lmx
PDBsum	5lmx
PubMed	28262097
UniProt	P46669\|RPA43_YEAST DNA-directed RNA polymerase I subunit RPA43 (Gene Name=RPA43)