Structure of PDB 5k2m Chain G Binding Site BS01

Receptor Information

>5k2m Chain G (length=273) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MRIGITYTVLRREEMAIKERAGEFGEVVMLHEDDLLFPGNYDLDVVIIRN
VSHFKALYTARLFESEGIPTVNSSRLIFEAGDKLFATLRLAGKVPVPEWK
AALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRDSLEAVLEHRKW
MKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYRYSNHWITNTARGG
KAEPCSDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKN
AARVTGADMAGKLVEYAVEVAKT

Ligand information

>5k2m Chain K (length=11) Species: 69014 (Thermococcus kodakarensis KOD1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ELPEVEEDWGE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5k2m Lysine Biosynthesis of Thermococcus kodakarensis with the Capacity to Function as an Ornithine Biosynthetic System.
Resolution	2.18 Å
Binding residue (original residue number in PDB)	V51 S52 H53 F54 F125 S127 W128 R130 Y156 R173 R187 T196 A197 N243 P244 N245 E247 F248 N250 A251
Binding residue (residue number reindexed from 1)	V51 S52 H53 F54 F125 S127 W128 R130 Y156 R173 R187 T196 A197 N243 P244 N245 E247 F248 N250 A251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0005524	ATP binding
GO:0043774	coenzyme F420-2 alpha-glutamyl ligase activity
GO:0046872	metal ion binding

	Biological Process
GO:0009085	lysine biosynthetic process
GO:0036211	protein modification process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5k2m, PDBe:5k2m, PDBj:5k2m
PDBsum	5k2m
PubMed	27566549
UniProt	Q5JFW0

[Back to BioLiP]