Structure of PDB 5jer Chain G Binding Site BS01

Receptor Information

>5jer Chain G (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTL
PGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGH
CHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGR
SPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLE
NTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQ

Ligand information

>5jer Chain H (length=10) Species: 28875 (Rotavirus A) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EEFELLISNS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jer Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins.
Resolution	2.913 Å
Binding residue (original residue number in PDB)	R211 V257 Y260 C267 H288 H290 G349 E350 S351 L362
Binding residue (residue number reindexed from 1)	R23 V69 Y72 C79 H100 H102 G161 E162 S163 L174

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5jer, PDBe:5jer, PDBj:5jer
PDBsum	5jer
PubMed	27302953
UniProt	Q14653\|IRF3_HUMAN Interferon regulatory factor 3 (Gene Name=IRF3)

[Back to BioLiP]