Structure of PDB 5ifj Chain G Binding Site BS01

Receptor Information

>5ifj Chain G (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSG
ISGSGGSTYYADSVKGRFTTSRDNSKNTLYLQMNSLRAEDTAVYYCAKFS
GKDCSGTSCRDYWGQGTLVTVSSASTKGPSVFPLAPAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK

Ligand information

>5ifj Chain I (length=9) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PLQPEQPFP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ifj Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	A38 W52 S57 Y66 G109 K110 D111
Binding residue (residue number reindexed from 1)	A33 W47 S52 Y59 G101 K102 D103

External links

PDB	RCSB:5ifj, PDBe:5ifj, PDBj:5ifj
PDBsum	5ifj
PubMed	28878138

[Back to BioLiP]