Structure of PDB 5ic4 Chain G Binding Site BS01

Receptor Information
>5ic4 Chain G (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEV
RNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVD
LKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ic4 Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
R64 H121 Q161 C163
Binding residue
(residue number reindexed from 1)
R29 H86 Q126 C128
Enzymatic activity
Catalytic site (original residue number in PDB) T62 S63 H121 G122 C163 R164
Catalytic site (residue number reindexed from 1) T27 S28 H86 G87 C128 R129
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5ic4, PDBe:5ic4, PDBj:5ic4
PDBsum5ic4
PubMed27367566
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]