Structure of PDB 5hq2 Chain G Binding Site BS01

Receptor Information
>5hq2 Chain G (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSV
LLPKK
Ligand information
>5hq2 Chain J (length=72) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatctgacacgtgcctggagaccgcgtacgtgcgtttaa
gcggtgctagagctgtctacga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hq2 Multivalent Interactions by the Set8 Histone Methyltransferase With Its Nucleosome Substrate.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		K15 R32
Binding residue
(residue number reindexed from 1)		K1 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5hq2, PDBe:5hq2, PDBj:5hq2
PDBsum5hq2
PubMed26953260
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]