Structure of PDB 5hjd Chain G Binding Site BS01

Receptor Information
>5hjd Chain G (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hjd Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain.
Resolution2.806 Å
Binding residue
(original residue number in PDB)		H56 S58 F59 Y78 A79 G80 F81
Binding residue
(residue number reindexed from 1)		H56 S58 F59 Y78 A79 G80 F81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5hjd, PDBe:5hjd, PDBj:5hjd
PDBsum5hjd
PubMed27105114
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]