Structure of PDB 5g4u Chain G Binding Site BS01

Receptor Information
>5g4u Chain G (length=117) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIA
EDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINE
GELRKELGSLVEKIKGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5g4u A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
Resolution2.65 Å
Binding residue
(original residue number in PDB)
K30 G31 T32 N33 E34 D54 I88 E89 V90 C92
Binding residue
(residue number reindexed from 1)
K30 G31 T32 N33 E34 D54 I88 E89 V90 C92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5g4u, PDBe:5g4u, PDBj:5g4u
PDBsum5g4u
PubMed27506301
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]