Structure of PDB 5fur Chain G Binding Site BS01

Receptor Information
>5fur Chain G (length=406) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQ
PLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEEN
GPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPG
QLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCP
LFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSH
SESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCA
YYSMIAAEQRLKDAGYGEKSFKIDDEVRTAPWNTTRAFIAAMKGKCLLEV
TGVADPTGCGEGFSYVKIPNKSVAEHQERYKEECQRIFDLQNKVLSSTEV
LSTDTD
Ligand information
>5fur Chain E (length=80) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agggcgcctataaaagggggtgggggcgcgttcgtcctcagtcgcgatcg
aacactcgagccgagcagacgtgcctacgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fur Structure of Promoter-Bound TFIID and Model of Human Pre-Initiation Complex Assembly.
Resolution8.5 Å
Binding residue
(original residue number in PDB)		R875 G877
Binding residue
(residue number reindexed from 1)		R267 G269
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001181 RNA polymerase I general transcription initiation factor activity
GO:0002039 p53 binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016301 kinase activity
GO:0016746 acyltransferase activity
GO:0016922 nuclear receptor binding
GO:0017025 TBP-class protein binding
GO:0043565 sequence-specific DNA binding
GO:0044024 histone H2AS1 kinase activity
GO:0046982 protein heterodimerization activity
GO:0061628 H3K27me3 modified histone binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061631 ubiquitin conjugating enzyme activity
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0070577 lysine-acetylated histone binding
GO:0106310 protein serine kinase activity
GO:0140416 transcription regulator inhibitor activity
GO:0140566 histone reader activity
GO:1905502 acetyl-CoA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000209 protein polyubiquitination
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006468 protein phosphorylation
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006974 DNA damage response
GO:0010629 negative regulation of gene expression
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0018107 peptidyl-threonine phosphorylation
GO:0030901 midbrain development
GO:0032092 positive regulation of protein binding
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034644 cellular response to UV
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046777 protein autophosphorylation
GO:0050821 protein stabilization
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:0071318 cellular response to ATP
GO:1901796 regulation of signal transduction by p53 class mediator
GO:1902806 regulation of cell cycle G1/S phase transition
GO:1905524 negative regulation of protein autoubiquitination
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005669 transcription factor TFIID complex
GO:0005730 nucleolus
GO:0071339 MLL1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fur, PDBe:5fur, PDBj:5fur
PDBsum5fur
PubMed27007846
UniProtP21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 (Gene Name=TAF1)

[Back to BioLiP]