Structure of PDB 5fj4 Chain G Binding Site BS01

Receptor Information
>5fj4 Chain G (length=118) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYI
AEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIIN
EGELRKELGSLVEKIKGL
Ligand information
>5fj4 Chain H (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagggagcgccauugcacuccggugcgaagaacuc
<<<...<<<<<..........>>>>>......>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fj4 A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
Resolution2.95 Å
Binding residue
(original residue number in PDB)
K30 G31 T32 N33 E34 V53 D54 P55 I58 I88 E89 V90 C92 A93
Binding residue
(residue number reindexed from 1)
K31 G32 T33 N34 E35 V54 D55 P56 I59 I89 E90 V91 C93 A94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5fj4, PDBe:5fj4, PDBj:5fj4
PDBsum5fj4
PubMed27016741
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]