Structure of PDB 5f5u Chain G Binding Site BS01

Receptor Information
>5f5u Chain G (length=194) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLAPNGLNPATIMEKAVRERIVESYFWKEQCFGVNEADIVDRVVEHVRF
VGGVTGVTQKPSPFLCLAFKLLQLAPGDDILKEYLYFGGEKFKYLRALAA
FYIRLTRPDKEVYTLLEPFLEDRRKLRRKGKNGTSLTYMDEFIDDLLTKD
RVCSTSLWKMRRRDILEDLDLLEPRVSPLGSLEDILEEEEQAAK
Ligand information
>5f5u Chain I (length=28) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKKATAEEVHARIEFLWQREQEKKKEQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f5u Scaffolding in the Spliceosome via Single alpha Helices.
Resolution2.748 Å
Binding residue
(original residue number in PDB)		E58 A59 D60 V62 D63 V66 E104 F108 K112
Binding residue
(residue number reindexed from 1)		E37 A38 D39 V41 D42 V45 E83 F87 K91
Enzymatic activity
Enzyme Commision number ?
External links