Structure of PDB 5bn6 Chain G Binding Site BS01

Receptor Information
>5bn6 Chain G (length=133) Species: 3489 (Artocarpus heterophyllus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVIYDLNGSPFVGQNHTSFITG
FTPVKISLDFPSEYIIEVSGHTGKVSGYVVVRSLAFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>5bn6 Chain B (length=19) Species: 3489 (Artocarpus heterophyllus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AEQSGKSQTVIVGPWGAQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bn6 Crystal Structure of Frutalin from Artocarpus incisa in complex with galactose
Resolution1.6499 Å
Binding residue
(original residue number in PDB)		T34 D57 G60 F84 P85 Y88 N134 G135 L136 L157
Binding residue
(residue number reindexed from 1)		T10 D33 G36 F60 P61 Y64 N110 G111 L112 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding

View graph for
Molecular Function
External links
PDB RCSB:5bn6, PDBe:5bn6, PDBj:5bn6
PDBsum5bn6
PubMed
UniProtQ38720

[Back to BioLiP]