Structure of PDB 5a0w Chain G Binding Site BS01

Receptor Information
>5a0w Chain G (length=178) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAAGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a0w Structural and Dynamical Characterization of the I- Dmo Catalytic Activity
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K86 Y89 N93 R97
Binding residue
(residue number reindexed from 1)		K82 Y85 N89 R93
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5a0w, PDBe:5a0w, PDBj:5a0w
PDBsum5a0w
PubMed
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]