Structure of PDB 4z89 Chain G Binding Site BS01

Receptor Information
>4z89 Chain G (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGEL
RGRRGYVPHNMVSEVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z89 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.64 Å
Binding residue
(original residue number in PDB)
F1324 Y1326 P1333 N1334 D1359 F1361 Y1372 P1374 N1376 M1377
Binding residue
(residue number reindexed from 1)
F8 Y10 P17 N18 D43 F45 Y56 P58 N60 M61
Enzymatic activity
Enzyme Commision number ?
External links