Structure of PDB 4z88 Chain G Binding Site BS01

Receptor Information
>4z88 Chain G (length=67) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEFRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWG
ELRGRRGYVPHNMVSEV
Ligand information
>4z88 Chain S (length=13) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRRKLPEIPKNKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F1324 Y1326 N1334 D1336 E1340 E1341 D1359 F1361 P1374 H1375 N1376
Binding residue
(residue number reindexed from 1)		F10 Y12 N20 D22 E26 E27 D45 F47 P60 H61 N62
Enzymatic activity
Enzyme Commision number ?
External links