Structure of PDB 4z1m Chain G Binding Site BS01

Receptor Information
>4z1m Chain G (length=187) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYSDRGLC
GAIHSSVAKQMKSVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVI
ALELLNSGYRFRSVISYKTQEYSLANIIYYSLKESTTSEQSARMTAMDNA
SKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Ligand information
>4z1m Chain I (length=28) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKREQAEEERYFRARAAEQLAALKKHHE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z1m How release of phosphate from mammalian F1-ATPase generates a rotary substep.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		N234 K237 N238 E241 M242 K245
Binding residue
(residue number reindexed from 1)		N149 K152 N153 E156 M157 K160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z1m, PDBe:4z1m, PDBj:4z1m
PDBsum4z1m
PubMed25918412
UniProtP05631|ATPG_BOVIN ATP synthase subunit gamma, mitochondrial (Gene Name=ATP5F1C)

[Back to BioLiP]